NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208044_1053474

Scaffold Ga0208044_1053474


Overview

Basic Information
Taxon OID3300027625 Open in IMG/M
Scaffold IDGa0208044_1053474 Open in IMG/M
Source Dataset NamePeat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1281
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil → Peatlands Soil Microbial Communities From Germany And Austria, That Are Sulfate Reducing

Source Dataset Sampling Location
Location NameGermany: Weissenstadt
CoordinatesLat. (o)50.1318Long. (o)11.881Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006575Metagenome / Metatranscriptome370Y
F007126Metagenome / Metatranscriptome357Y
F012935Metagenome / Metatranscriptome276Y

Sequences

Protein IDFamilyRBSSequence
Ga0208044_10534741F012935N/ARFVLIAGMHRWHELLAEGDYGRPSEISAQLVRLADQGPDAGLHVVAWADGYATAERALRRAGIGFFGLRAVLRVLSPAESDSLLGVSAAASLDDDRALFRDTEWPAEQVEKFKPYSTASLYAFAQEMFRSPA
Ga0208044_10534742F006575GGAGMTESPYLSLRQAVRPAILAHWLLAGDQERAGKLAAECEDLLFLTRELLKAAGRVRILGGPVPASDGPDPAERAGDRHAQLLDAYAEAGLLWAKVVGCSVALAEALIDRGEWDDVRRLADFLAGAGEESAAADLRIQLGKAVFQMHREQLQAISNTMPPAAIGKAIDALRAVLREVPEDFPDRNREVNRFLPPLASAIHAIMKDQDVDLPLTSRVEHIATGGVAKYPDIVTMSLDELAAEFEGTCS
Ga0208044_10534743F007126AGGAGMAGVINDIEALAEFRAQLMRFNHDLAENFATIQSHWRE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.