Scaffold Ga0208044_1041007

Overview

Basic Information

• Taxon OID: 3300027625
• Scaffold ID: Ga0208044_1041007
• Source Dataset Name: Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1522
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil → Peatlands Soil Microbial Communities From Germany And Austria, That Are Sulfate Reducing

Source Dataset Sampling Location

• Location Name: Germany: Weissenstadt
• Coordinates
  • Lat. (^o): 50.1318
  • Long. (^o): 11.881

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080330	Metagenome	115	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0208044_10410072	F080330	N/A	APFILSLLAAGTVLAGDPFSGPDANQSGLADGVRLSARVVENVYLMPEQITKLIFPKAVEEVSVNTQVINIGRNPPDSKEYYLLLSPKVAQGDVDMHVVLEGKTYTFRLIVGRDKVNYRKTYTAEGGGSGRSLRKVPPLAPTEINTTRLIHIINQSMRDPNYASVVAKDIGSSPQGATYLWDGAEVVLQSAWHYYPQDVVILQVEVHNPTSRAVYLSATQLDPFIANTTLHYLLTQQGTKVLLPGQTDIKYIFLQGCGVDIEGARFELRLPAAGTQLNAQPQQNP