NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209753_1016295

Scaffold Ga0209753_1016295


Overview

Basic Information
Taxon OID3300027622 Open in IMG/M
Scaffold IDGa0209753_1016295 Open in IMG/M
Source Dataset NameMarine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_3_550m (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2455
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Oxygen Minimum Zone In The Mesopelagic Equatorial Pacific

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)8.0Long. (o)-156.0Alt. (m)Depth (m)550
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029778Metagenome187Y

Sequences

Protein IDFamilyRBSSequence
Ga0209753_10162951F029778AGGAMKNKDLFQELRFQLNYYQLKLEMWWYHLWETEEERIEIREALRKRRESGGCSMWRNYLKGHPEAAKYAWEKEFVKGIKKINE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.