NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209330_1000003

Scaffold Ga0209330_1000003


Overview

Basic Information
Taxon OID3300027619 Open in IMG/M
Scaffold IDGa0209330_1000003 Open in IMG/M
Source Dataset NameForest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)208638
Total Scaffold Genes182 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)150 (82.42%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location
Location NameAlgoma, Ontario, Canada
CoordinatesLat. (o)46.42Long. (o)-83.37Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001450Metagenome / Metatranscriptome692Y
F002623Metagenome / Metatranscriptome542Y
F004096Metagenome / Metatranscriptome453Y
F083013Metagenome / Metatranscriptome113Y

Sequences

Protein IDFamilyRBSSequence
Ga0209330_1000003153F002623AGGMLIREYTDADFDALRRIHAQQGFDYAFPDLADPLFVSKLVVEDDAGRAVMASLARLTCEMYLLSAPGEGNPRERYARLLALHRAGERDLLARGLHDAHAWLPPPIARKFGRRLAALGWVRDDAWTPYCHRLIL
Ga0209330_1000003169F001450N/AVSSTPTGSTLRNTAKPDVCFTRVAIAQEYKSLYSLIRVTRETHETPAGVQELAARAGGVNRYGEANFRVVWGGSRLAWVGGRWTDRDAHGNTIRETVEMRRVPKYLPEDRWHIERWMPAESYGSPEQWLAQTTEVEDGVRIAALGPYPSRGDYEHCFTIESARGEFIPLTPAACDWIVRAIEWSRRQRRTEMRGAIAAREARRERHMDRGMDDILDDAVPAFHGEPFVVGA
Ga0209330_100000375F083013AGGMQTVNDSSGRYGTLGVLWAVYAILRFAGAAFIVVYEPMLTVMWGAIITRVANPDALMSLFHLFLIFAVVLSIIAGIVSLLAAIALLGRAGSARTLALVASFFGLINGPLGVALGAYTLVVFVPRGATSS
Ga0209330_100000387F004096AGGAGMKNFENLFAAWMVVWAVFFVYELSIAQRLSRLRDDVEGLKRQLRER
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.