| Basic Information | |
|---|---|
| Taxon OID | 3300027618 Open in IMG/M |
| Scaffold ID | Ga0208736_1008092 Open in IMG/M |
| Source Dataset Name | Polar desert microbial communities from Antarctic Dry Valleys - UQ255 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2643 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (83.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert → Polar Desert Microbial Communities From Antarctic Dry Valleys |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Antarctic Dry Valleys | |||||||
| Coordinates | Lat. (o) | -78.0486 | Long. (o) | 163.8053 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F013996 | Metagenome / Metatranscriptome | 266 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0208736_10080922 | F013996 | GAG | MSRTTLILISYVEAALLVVILSIGLNQVRRRLTIISNGLAELAGMLASVESQHLRGLMGWVADINAPLQVIAGVLPGIAAKAALVVRKATGG |
| ⦗Top⦘ |