Scaffold Ga0209122_1173590

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209122_1173590

Scaffold Ga0209122_1173590

Overview

Basic Information
Taxon OID	3300027613 Open in IMG/M
Scaffold ID	Ga0209122_1173590 Open in IMG/M
Source Dataset Name	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 2 (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1028
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont → Marine Gutless Worms Symbiont Microbial Communities From Various Locations

Source Dataset Sampling Location
Location Name	Italy: Sant'Andrea, Tuscany
Coordinates	Lat. (^o)	42.8072	Long. (^o)	10.1411	Alt. (m)		Depth (m)	6
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076576	Metagenome	118	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209122_11735901	F076576	AGGA	VRVAGRVYRYGVRDLEVMVESLSGGSRPEMQEEGRVMELKIFLFKYSRRSWREANWVRLSAT

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.