| Basic Information | |
|---|---|
| Taxon OID | 3300027611 Open in IMG/M |
| Scaffold ID | Ga0210059_1132752 Open in IMG/M |
| Source Dataset Name | Ecteinascidia turbinata endosymbiont from Florida, USA - Sample 2 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1062 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Tunicates → Ascidians → Unclassified → Unclassified → Ecteinascidia Turbinata → Ecteinascidia Turbinata Symbiotic Microbial Communities From The Caribbean Mangrove |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Key West, Florida, United States | |||||||
| Coordinates | Lat. (o) | 24.5512 | Long. (o) | -81.8083 | Alt. (m) | Depth (m) | 2 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F065206 | Metagenome | 128 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0210059_11327522 | F065206 | AGG | MVVYILPSNAKPLLGLFCNSNCIHRCSHITLSFSRNVNIVEWLVSMPGVRLFVGSALTISFGLAFRGCTFNRSAFNVLFQNV |
| ⦗Top⦘ |