Basic Information | |
---|---|
Taxon OID | 3300027611 Open in IMG/M |
Scaffold ID | Ga0210059_1087376 Open in IMG/M |
Source Dataset Name | Ecteinascidia turbinata endosymbiont from Florida, USA - Sample 2 (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2070 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Host-Associated → Tunicates → Ascidians → Unclassified → Unclassified → Ecteinascidia Turbinata → Ecteinascidia Turbinata Symbiotic Microbial Communities From The Caribbean Mangrove |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Key West, Florida, United States | |||||||
Coordinates | Lat. (o) | 24.5512 | Long. (o) | -81.8083 | Alt. (m) | Depth (m) | 2 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F094522 | Metagenome | 106 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0210059_10873762 | F094522 | N/A | MIKNVTEITGNSEKSELDVMTFHDVIRVANENTRENLYIPVSLLGSVS |
⦗Top⦘ |