NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210059_1054911

Scaffold Ga0210059_1054911


Overview

Basic Information
Taxon OID3300027611 Open in IMG/M
Scaffold IDGa0210059_1054911 Open in IMG/M
Source Dataset NameEcteinascidia turbinata endosymbiont from Florida, USA - Sample 2 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3691
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Tunicates → Ascidians → Unclassified → Unclassified → Ecteinascidia Turbinata → Ecteinascidia Turbinata Symbiotic Microbial Communities From The Caribbean Mangrove

Source Dataset Sampling Location
Location NameKey West, Florida, United States
CoordinatesLat. (o)24.5512Long. (o)-81.8083Alt. (m)Depth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F074136Metagenome120Y

Sequences

Protein IDFamilyRBSSequence
Ga0210059_10549112F074136GAGMQDLRKSQAWSINSGKMESNPGDFPGFRRLRAAANSSGLKGSEIL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.