| Basic Information | |
|---|---|
| Taxon OID | 3300027607 Open in IMG/M |
| Scaffold ID | Ga0207422_1000165 Open in IMG/M |
| Source Dataset Name | Marine cyanobacterial communities from Panama - species 1 Leptolyngbya sp. (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 255941 |
| Total Scaffold Genes | 249 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 206 (82.73%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Cyanobacterial Communities From Panama, Similar To Oscillatoria Species |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Panama: Panama City | |||||||
| Coordinates | Lat. (o) | 9.28 | Long. (o) | -79.97 | Alt. (m) | Depth (m) | 48.85 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F008191 | Metagenome / Metatranscriptome | 337 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0207422_1000165241 | F008191 | GGAG | MTARLTCADCRWWHFQSTETAASRDDEQAVGYCRRMPPERRENGVGAWPITFPTDWCGEYVHKDDVSYQIGEGFTAVS |
| ⦗Top⦘ |