Basic Information | |
---|---|
Taxon OID | 3300027598 Open in IMG/M |
Scaffold ID | Ga0255121_1045039 Open in IMG/M |
Source Dataset Name | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepB_8h |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 897 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: New York | |||||||
Coordinates | Lat. (o) | 45.0061 | Long. (o) | -74.7949 | Alt. (m) | Depth (m) | 5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F011754 | Metagenome / Metatranscriptome | 287 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0255121_10450392 | F011754 | GGA | MKMGFSLGRCVRDIVKGSVDINDVAFIIAATSIHDEPQLANVIEQYMFRDDDYLYGLDESKCQAVALELWSTNKILQPRRQGMHRHRQPENSVWVDMFPTELSKNHSVKSAWDAYRFMLHMVENVDNEAVEVFKQ |
⦗Top⦘ |