Scaffold Ga0255122_1004553

Overview

Basic Information

• Taxon OID: 3300027595
• Scaffold ID: Ga0255122_1004553
• Source Dataset Name: Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepC_8h
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3043
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location

• Location Name: USA: New York
• Coordinates
  • Lat. (^o): 45.0061
  • Long. (^o): -74.7949
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011641	Metagenome	288	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0255122_10045535	F011641	AGCAG	MADERLALVDKILAYVSSPFRLFALVLMAVLTFAGYFVYTNQDLLIGAYKESKKIPTIAEDRVEDAAAHLFKQSGALVVAVFKVNSMFGTRILYRAYGKNGRDKTNDGLDVGLFTQNAANNADVVKLMASEIPCGEYKSAQSEMGLWYIAK