Scaffold Ga0209150_1196144

Overview

Basic Information

• Taxon OID: 3300027585
• Scaffold ID: Ga0209150_1196144
• Source Dataset Name: Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.3 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 885
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts → Marine Gutless Worms Symbiont → Marine Gutless Worms Symbiont Microbial Communities From Various Locations

Source Dataset Sampling Location

• Location Name: Max Planck institute for Marine Microbiology, Germany
• Coordinates
  • Lat. (^o): 51.321602
  • Long. (^o): 12.394572

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001451	Metagenome	692	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209150_11961441	F001451	N/A	KQAYRVVHQPVSRGFTVFADAWLSSWLAEISAELRETVAH