| Basic Information | |
|---|---|
| Taxon OID | 3300027584 Open in IMG/M |
| Scaffold ID | Ga0209637_1342656 Open in IMG/M |
| Source Dataset Name | Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 3 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 659 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont → Marine Gutless Worms Symbiont Microbial Communities From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Zanca-sant'andrea, Tuscany, Italy | |||||||
| Coordinates | Lat. (o) | 42.8072 | Long. (o) | 10.1411 | Alt. (m) | Depth (m) | 6 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F094499 | Metagenome | 106 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209637_13426561 | F094499 | N/A | LMPNTTQFERPPYSITSYSVNSGLIEWIKTVPTVG |
| ⦗Top⦘ |