Scaffold Ga0207714_1172786

Overview

Basic Information

• Taxon OID: 3300027580
• Scaffold ID: Ga0207714_1172786
• Source Dataset Name: Marine sediment microbial community from Fremont, CA, USA - Pond A23 Sediment 2 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 550
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico

Source Dataset Sampling Location

• Location Name: Alviso Ponds, San Francisco, CA, USA
• Coordinates
  • Lat. (^o): 37.474067
  • Long. (^o): -121.973033
  • Depth (m): .075

Associated Families

Family	Category	Number of Sequences	3D Structure?
F062489	Metagenome	130	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0207714_11727863	F062489	GGAG	MTGPDAIVIRERRPEAPTRRLVYHRLTTGGYDRKTQLWRQAIDGWHTTGTEVVTALRIDCPEGRR