Basic Information | |
---|---|
Taxon OID | 3300027580 Open in IMG/M |
Scaffold ID | Ga0207714_1127011 Open in IMG/M |
Source Dataset Name | Marine sediment microbial community from Fremont, CA, USA - Pond A23 Sediment 2 (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 707 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Alviso Ponds, San Francisco, CA, USA | |||||||
Coordinates | Lat. (o) | 37.474067 | Long. (o) | -121.973033 | Alt. (m) | Depth (m) | .075 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F000388 | Metagenome / Metatranscriptome | 1201 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0207714_11270112 | F000388 | N/A | MKVIKVTKDYFETEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKEMKDGKSSNRL |
⦗Top⦘ |