NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255075_1023588

Scaffold Ga0255075_1023588


Overview

Basic Information
Taxon OID3300027578 Open in IMG/M
Scaffold IDGa0255075_1023588 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8h
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1185
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: Oregon
CoordinatesLat. (o)46.1812Long. (o)-123.1834Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000962Metagenome / Metatranscriptome820Y
F012669Metagenome / Metatranscriptome278Y

Sequences

Protein IDFamilyRBSSequence
Ga0255075_10235882F012669N/AMSEQTYMKLKDAVKRPVFDAKTINRENPRFKSLVDSYQKWNQDDYFTEHRSTYENDIIECLEEYDLDGFALAQHLSEYKYIEPDSELVHILEDVTFVKSSLETEMLSQWVMENFLTIPDDVVGKNVNVKQGIRKYENHYITGIKPETYQVTVSDKIDKNGGYIVGFENVTFL
Ga0255075_10235883F000962GGALLRICVYHNDFTIGFPKSDMNIHVPDEIKAKYPHMEFRGKQRQLNDRTVIEAYNNATNQTFHYSFDEDFFWFAGQIPDWKLKKVS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.