| Basic Information | |
|---|---|
| Taxon OID | 3300027574 Open in IMG/M |
| Scaffold ID | Ga0208982_1048800 Open in IMG/M |
| Source Dataset Name | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O3 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 841 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | El Dorado National Forest, Georgetown, California, USA | |||||||
| Coordinates | Lat. (o) | 38.88 | Long. (o) | -120.64 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F017897 | Metagenome / Metatranscriptome | 238 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0208982_10488002 | F017897 | N/A | RKQSQTARTLKGSGYQLMTTYTPDHAVAICVNNPVDLVILDQEHFIQTEGWSVAKSVKMIRQKVCVILVVRGKIVGSEPPDGVDAVVPDHDAQSLIATIKHILKGF |
| ⦗Top⦘ |