NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208454_1001977

Scaffold Ga0208454_1001977


Overview

Basic Information
Taxon OID3300027573 Open in IMG/M
Scaffold IDGa0208454_1001977 Open in IMG/M
Source Dataset NameSoil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7426
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (90.91%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.8898Long. (o)-106.9077Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016408Metagenome / Metatranscriptome247Y
F025043Metagenome / Metatranscriptome203Y
F096805Metagenome104Y

Sequences

Protein IDFamilyRBSSequence
Ga0208454_10019771F016408N/ARPGGSFQYFNPDGGDLGRGGGPTFDKAVLNCVFLSENIEYTKLTQWATDDARKAIINSVRRLTATALDEMRRQLDSQMMQTGDGVIGVVTTDTPAGGSNVLTFTTDGFGVRLMRFGQTVQVYDTTLATLKGKGTISGYDVENKTVTLTPQVAGVIAGDKIVTDGLSAPASLPALFGVPYHHSNASAGTWLGFSRSTTPEIRANRVNAGSAGLTLPLPRLAMNKIGNRLGTEKEFNPTAWLHPCQIQAYEEIGQLVSVIQKTTKEEGLNLYFGSNMQLAGASTKPHFSWDKTRIDFVVDEVWGRAEILPIGFYTTDGRKIFEIRGASGGVAAAEIFYMVVGMQTYVSNPAACSYIDNLAVPVGY
Ga0208454_100197711F096805GGAGMPKGAAISEGSSGDNISHFAAIRIRVVGTGNLKMSVGCLGVRSKTLVPFVLQAINRMLMTRIVNFMETRAFFQIQTTEIDEYFRINRIVV
Ga0208454_10019775F025043AGGAGMQVGEFPGMAQANRRTVRAPVNPMDKSTVVSILPKVIMERKATIQPGIFELKKGSLENPAILVVGASSWWREVDIDQPLLEIPVSSIQIADSIVRDYCNGLLACNMADLMPGLFYLPGEFTVAKLKAEHEPLLKKAAANQKRWFLELVRIADILWSRSNGNPLAISEDARIACRELNITQKPWLGDLQTAELVRCIACGNLRNPQFPVCAVCKAIADPVKAKELNIVFAQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.