Scaffold Ga0209639_1016915

Overview

Basic Information

• Taxon OID: 3300027566
• Scaffold ID: Ga0209639_1016915
• Source Dataset Name: Bioremediated contaminated groundwater from EPA Superfund site, New Mexico - Sample HSE6-05 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2706
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioremediation → Tetrachloroethylene And Derivatives → Tetrachloroethylene → Unclassified → Bioremediated Contaminated Groundwater → Bioremediated Contaminated Groundwater Microbial Communities From North Railroad Avenue Plume (Nrap), New Mexico

Source Dataset Sampling Location

• Location Name: Espanola, New Mexico, United States
• Coordinates
  • Lat. (^o): 35.9918
  • Long. (^o): -106.0796

Associated Families

Family	Category	Number of Sequences	3D Structure?
F049012	Metagenome / Metatranscriptome	147	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209639_10169153	F049012	N/A	LAFFKLMPEVVFQFQDKTKLVEKRFLSCLNKYLDEYSGQDRIVLSDSCDFDVFCHFIDFLVSGHIPSDRNDQIGVINLLREWESHFGIVDSFRFRLCCQEKDGIVVYNGDKHEVNIGCLLFHSLVFREFYKNSCGMVFNFDSSYSRESFEVFLDLIHNRISYPSVEKAG