| Basic Information | |
|---|---|
| Taxon OID | 3300027566 Open in IMG/M |
| Scaffold ID | Ga0209639_1007128 Open in IMG/M |
| Source Dataset Name | Bioremediated contaminated groundwater from EPA Superfund site, New Mexico - Sample HSE6-05 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5386 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Metamonada → Parabasalia → Tritrichomonadida → Tritrichomonadidae → Tritrichomonas → Tritrichomonas foetus | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Bioremediation → Tetrachloroethylene And Derivatives → Tetrachloroethylene → Unclassified → Bioremediated Contaminated Groundwater → Bioremediated Contaminated Groundwater Microbial Communities From North Railroad Avenue Plume (Nrap), New Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Espanola, New Mexico, United States | |||||||
| Coordinates | Lat. (o) | 35.9918 | Long. (o) | -106.0796 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F049012 | Metagenome / Metatranscriptome | 147 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209639_10071284 | F049012 | GAG | MKIELKLAFYLLMPEVVFQCQDKTKHVEKRFLSCLNKYLDEYTTKDRIVLSDSCVFDVFCHFIDFLVLGSIPSDRNDQIGVINLLREWESHFGIVDSFRFRLCCQEKDGIVVYNGDKYEVNIGCLLFHSDIFREFYKNSCGMVFHFDSSYSRESFEVFLDLIHNRISYPSVEKAGDVYDICNCLHC |
| ⦗Top⦘ |