Scaffold Ga0209219_1000188

Overview

Basic Information

• Taxon OID: 3300027565
• Scaffold ID: Ga0209219_1000188
• Source Dataset Name: Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 8401
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (71.43%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location

• Location Name: Thunder Bay, Ontario, Canada
• Coordinates
  • Lat. (^o): 49.08
  • Long. (^o): -89.38

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030012	Metagenome	186	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209219_10001886	F030012	AGG	MTVAKVIEFYIPNTFRKSVKWVCPEQRGKIIEFVSQIKKSA