Basic Information | |
---|---|
Taxon OID | 3300027564 Open in IMG/M |
Scaffold ID | Ga0209428_1147600 Open in IMG/M |
Source Dataset Name | Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 1 (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1221 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Elopocephalai → Elopocephala → Elopomorpha → Anguilliformes → Anguillidae → Anguilla → Anguilla anguilla | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont → Marine Gutless Worms Symbiont Microbial Communities From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Zanca-sant'andrea, Tuscany, Italy | |||||||
Coordinates | Lat. (o) | 42.8072 | Long. (o) | 10.1411 | Alt. (m) | Depth (m) | 6 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F011346 | Metagenome | 292 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209428_11476001 | F011346 | N/A | TWRPGSEGMSLACCEDRMMICGIVLRQHRNVTDDRRHAHGI |
⦗Top⦘ |