NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209887_1011584

Scaffold Ga0209887_1011584


Overview

Basic Information
Taxon OID3300027561 Open in IMG/M
Scaffold IDGa0209887_1011584 Open in IMG/M
Source Dataset NameGroundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2279
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand → Groundwater Microbial Communities From The Columbia River, Washington, Usa

Source Dataset Sampling Location
Location NameUSA: Columbia River, Washington
CoordinatesLat. (o)46.372Long. (o)-119.272Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000329Metagenome / Metatranscriptome1287Y

Sequences

Protein IDFamilyRBSSequence
Ga0209887_10115842F000329GGAGGMEGKAMLAEQEARAFSGESWPVGEPVTLVIEEERFFGWVAAASQAHSLVRVPIEFKRGDKRVQELIPVENIQRLRAYLQAHPELRKAKEKGTPLRKG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.