Scaffold Ga0209531_10016702

Overview

Basic Information

• Taxon OID: 3300027558
• Scaffold ID: Ga0209531_10016702
• Source Dataset Name: Cubitermes ugandensis crop segment gut microbial communities from Kakamega Forest, Kenya - Cu122C (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1455
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut → Cubitermes And Nasutitermes Termite Gut Microbial Communities From Max Planck Institute For Terrestrial Microbiology, Germany

Source Dataset Sampling Location

• Location Name: Kakamega Forest, Kenya
• Coordinates
  • Lat. (^o): 0.2917
  • Long. (^o): 34.856

Associated Families

Family	Category	Number of Sequences	3D Structure?
F027882	Metagenome	193	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209531_100167021	F027882	N/A	IEVSPILITFIYQRSKQHQGGLNRIHQADSPVISEDTNLKKLLVVGKEKGSILQDSVKCVLCIRSEVKLNSALFCFTEGLVLRNTI