NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207752_1008915

Scaffold Ga0207752_1008915


Overview

Basic Information
Taxon OID3300027555 Open in IMG/M
Scaffold IDGa0207752_1008915 Open in IMG/M
Source Dataset NameMarine sediment microbial community from Union City, CA, USA - Pond 2C Sediment 2 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2880
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico

Source Dataset Sampling Location
Location NameEden Landing Ponds, San Francisco, CA, USA
CoordinatesLat. (o)37.569017Long. (o)-122.102433Alt. (m)Depth (m).11
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F091298Metagenome / Metatranscriptome107Y

Sequences

Protein IDFamilyRBSSequence
Ga0207752_10089151F091298GAGGMSSVVTLRVSSSAQVLQHLSIGEPIQDTRVTDLLDLDPLVVSRWLCGEDMRGVYQPIVVRRCALDGIDLEGRTFYEIVELVGCHIAAAHFRNAYFYSSLLVEDCVFDGDFDGRGMQSDGRVVFHNTIFTGWADFSALSMRGRADLVDVSFPGGTNLLRTLVSGSRDQLGHEVNLSGCRFRAADIPDELEAARGGILPLVDRDSGGMERQWRKLVRGKKGDPVGIVSRLLFSSHQPGTVDNDDVCTALVLSPGCNVE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.