Scaffold Ga0207752_1002145

Overview

Basic Information

• Taxon OID: 3300027555
• Scaffold ID: Ga0207752_1002145
• Source Dataset Name: Marine sediment microbial community from Union City, CA, USA - Pond 2C Sediment 2 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 8351
• Total Scaffold Genes: 14
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 8 (57.14%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico

Source Dataset Sampling Location

• Location Name: Eden Landing Ponds, San Francisco, CA, USA
• Coordinates
  • Lat. (^o): 37.569017
  • Long. (^o): -122.102433
  • Depth (m): .11

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025653	Metagenome / Metatranscriptome	200	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0207752_100214514	F025653	AGAAG	MSDPIKFFETKLKDMSLAELQDYKKRLEENIQQMIAKTAPNEKIAPLIIYRGILEHEIKARTTQR