Scaffold Ga0209255_1007625

Overview

Basic Information

• Taxon OID: 3300027550
• Scaffold ID: Ga0209255_1007625
• Source Dataset Name: Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius vacuus BAHAMAS.2 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4329
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (25.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont → Marine Gutless Worms Symbiont Microbial Communities From Various Locations

Source Dataset Sampling Location

• Location Name: Bremen, Bremen, Germany
• Coordinates
  • Lat. (^o): 53.109679
  • Long. (^o): 8.847516

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007963	Metagenome	341	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209255_10076251	F007963	GAG	MAYHHNVAVKRKKRLIVLMMLDRPTDLYDNDASDTATLRQFVRQYTYIDYKADDWLDRLLYALPLRGLLQNNHHRNDTQLLEN