NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255125_1090531

Scaffold Ga0255125_1090531


Overview

Basic Information
Taxon OID3300027534 Open in IMG/M
Scaffold IDGa0255125_1090531 Open in IMG/M
Source Dataset NameFreshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_8d
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)625
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: New York
CoordinatesLat. (o)45.0061Long. (o)-74.7949Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F022415Metagenome / Metatranscriptome214Y
F046380Metagenome / Metatranscriptome151N

Sequences

Protein IDFamilyRBSSequence
Ga0255125_10905312F022415AGGAGMSKMSNLHMVITDAIACDLSEDLIIDLMVEEGLPREACPEILRVFKQVESV
Ga0255125_10905313F046380GGAGMNWKTLDQSFETMSQAEALDIVQQEAVSMGMGLLETMTWMSDNYDELDSVQKNAFRTAFRGFQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.