NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209537_1138073

Scaffold Ga0209537_1138073


Overview

Basic Information
Taxon OID3300027510 Open in IMG/M
Scaffold IDGa0209537_1138073 Open in IMG/M
Source Dataset NameBiogas fermentation microbial communities from Germany - Plant 4 DNA1 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)503
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified → Biogas Fermentantion → Biogas Fermentation Microbial Communities From Biogas Plants In Germany

Source Dataset Sampling Location
Location NameBielefeld, North Rhine-Westphalia, Germany
CoordinatesLat. (o)52.0385Long. (o)8.4956Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F090570Metagenome / Metatranscriptome108N

Sequences

Protein IDFamilyRBSSequence
Ga0209537_11380731F090570AGGVNEFGNAYIEKVWCNSVKSPRPLKVIPYKKDFKVFFSVRGTEIGRITIGIFVDDILDQMLTTNILEINKSLAIWFWYPYKRKQIGKHVIQFKIGEATDRTADSVTWKYTSDKYIVEVK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.