| Basic Information | |
|---|---|
| Taxon OID | 3300027510 Open in IMG/M |
| Scaffold ID | Ga0209537_1103623 Open in IMG/M |
| Source Dataset Name | Biogas fermentation microbial communities from Germany - Plant 4 DNA1 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 656 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified → Biogas Fermentantion → Biogas Fermentation Microbial Communities From Biogas Plants In Germany |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Bielefeld, North Rhine-Westphalia, Germany | |||||||
| Coordinates | Lat. (o) | 52.0385 | Long. (o) | 8.4956 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F086520 | Metagenome / Metatranscriptome | 110 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209537_11036232 | F086520 | GAG | MTKNKKVVNKAFEQAAFETETRKREKERIRRRRYTPMTKAQFKYWVMRDLGLLEEYYDDF |
| ⦗Top⦘ |