NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209537_1037422

Scaffold Ga0209537_1037422


Overview

Basic Information
Taxon OID3300027510 Open in IMG/M
Scaffold IDGa0209537_1037422 Open in IMG/M
Source Dataset NameBiogas fermentation microbial communities from Germany - Plant 4 DNA1 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1725
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → unclassified Eubacteriales → Clostridiales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified → Biogas Fermentantion → Biogas Fermentation Microbial Communities From Biogas Plants In Germany

Source Dataset Sampling Location
Location NameBielefeld, North Rhine-Westphalia, Germany
CoordinatesLat. (o)52.0385Long. (o)8.4956Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014634Metagenome / Metatranscriptome261Y
F022612Metagenome / Metatranscriptome213Y

Sequences

Protein IDFamilyRBSSequence
Ga0209537_10374221F022612AGGAGGMRTIVTKEYTRVRKNVARKLFNEGRIIYLTPSNIVATDSSPWIKPYPINNRAGDNFDDIVNRYEYYNCNYELGYYTNFWINEEKEAISWQ
Ga0209537_10374222F014634AGGAGGMRQKLSELFNLELIQKLAEKNINHTNWIEEDCGERRRILEVVTLFHGGNGAHIPGMVLEMFEQAEGYDLENPYNWEKNATIHDALMFLENEVNDCLNELLPSKGRYYVGYHEFDGSYCLFYEEYKEVNE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.