| Basic Information | |
|---|---|
| Taxon OID | 3300027506 Open in IMG/M |
| Scaffold ID | Ga0208973_1014635 Open in IMG/M |
| Source Dataset Name | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_66_BLW_10 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2516 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique → Candidatus Pelagibacter ubique HTCC1062 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Monterey Bay, California, USA | |||||||
| Coordinates | Lat. (o) | 36.25 | Long. (o) | -122.2099 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F006001 | Metagenome / Metatranscriptome | 384 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0208973_10146352 | F006001 | N/A | MKYFLPIIILIFFLSGCAKHVGVHNKDNSSLFTSSFETKTGGSISDHILFGKDSIELVNIAKLRCKKISTKHKVKNFRRTFLGTIITDQMSLYEYDCEKDKD |
| ⦗Top⦘ |