Scaffold Ga0208948_1030844

Overview

Basic Information

• Taxon OID: 3300027501
• Scaffold ID: Ga0208948_1030844
• Source Dataset Name: Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_17_M020 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1170
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing

Source Dataset Sampling Location

• Location Name: Monterey Bay, California, USA
• Coordinates
  • Lat. (^o): 36.25
  • Long. (^o): -122.2099

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018081	Metagenome	237	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208948_10308442	F018081	AGGTGG	MKHFKEREFTLFNYMCDILFEFYEKNGLEHCCALESRMGGNYKTEEQKEWLERFSDVWERVEQREINKG