Scaffold Ga0209145_1005867

Overview

Basic Information

• Taxon OID: 3300027500
• Scaffold ID: Ga0209145_1005867
• Source Dataset Name: Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius filocauda PIANOSA.2 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5130
• Total Scaffold Genes: 9
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (22.22%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont → Marine Gutless Worms Symbiont Microbial Communities From Various Locations

Source Dataset Sampling Location

• Location Name: Germany: Marburg
• Coordinates
  • Lat. (^o): 50.8
  • Long. (^o): 8.81

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018871	Metagenome	232	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0209145_10058679	F018871	GGAG	VVSVTSSPLHIAAAAAAAAGVDSWSIQSNIGCGTKTQPWMLEAPAGQRINISLLDFTA