Scaffold Ga0207553_1001801

Overview

Basic Information

• Taxon OID: 3300027435
• Scaffold ID: Ga0207553_1001801
• Source Dataset Name: Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G05K3-12 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1040
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Chelatococcaceae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Source Dataset Sampling Location

• Location Name: USA: Michigan
• Coordinates
  • Lat. (^o): 42.4
  • Long. (^o): -85.37
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078804	Metagenome	116	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0207553_10018011	F078804	N/A	AQKIDLREVRLNFANIILRPLVALVLCSVIAPAIGHAKEKAQSSRQAANKAVKKQASVFDSDGYRLVSPNSTMRCAQTLRGTLDCKE