NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209421_1001000

Scaffold Ga0209421_1001000


Overview

Basic Information
Taxon OID3300027432 Open in IMG/M
Scaffold IDGa0209421_1001000 Open in IMG/M
Source Dataset NameForest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4625
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (71.43%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location
Location NameThunder Bay, Ontario, Canada
CoordinatesLat. (o)49.08Long. (o)-89.38Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003185Metagenome / Metatranscriptome502Y
F019709Metagenome / Metatranscriptome228Y
F056182Metagenome / Metatranscriptome138Y

Sequences

Protein IDFamilyRBSSequence
Ga0209421_10010003F003185AGGMKIRLRWNFTVTACTLLMVNIALAQEAPKQDTSGTLTIVTAGDISITRAANGKTAVSISFVSGKAKSGDIRIAISGPYFLDVNGGVKEVNGPRGIELHVLSHEDLRFEAPEVASWEQSHRFSQNSACMKIPKFPGCGNPVCDQPDHPDDQCRYNSDSGCSCVAPGGGPCSETANPAQERKSSRD
Ga0209421_10010004F056182GAGGMSKLADAMAERSAVRKAAPARRLKKERGAPAPSVPQAPAEAGTHPKIGDLPVRAHLEKGISELQGLHELLLSNEVDPDVLADFRDSLNRVRNTAWAAQQYVVRKEVDHDSTSVLSFLAGERIRVAYQLCQTLSDDLRKTEIEFQRGSLVQLCEITRTLTKQLKNIIDKL
Ga0209421_10010005F019709GGAGVRSYIKLGCILCIWALWKATANMAFCYLLWITTLAWVVRYIISSKVKGGFLILLGITCNALVTLLNGGVMPSVGVSPTFQPAAPIWNVSGKGQWLLLADQGALYRFSIGDIFLIAGFLIFLIGTVERRRLIIPIKEGSIANSE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.