Scaffold Ga0209780_1004446

Overview

Basic Information

• Taxon OID: 3300027389
• Scaffold ID: Ga0209780_1004446
• Source Dataset Name: Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus exumae BAHAMAS.2 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 10793
• Total Scaffold Genes: 10
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Coelacanthimorpha → Coelacanthiformes → Coelacanthidae → Latimeria → Latimeria chalumnae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont → Marine Gutless Worms Symbiont Microbial Communities From Various Locations

Source Dataset Sampling Location

• Location Name: Germany: Marburg
• Coordinates
  • Lat. (^o): 50.8
  • Long. (^o): 8.81

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000035	Metagenome	4444	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209780_10044466	F000035	GGAG	VLDTVKARKLAYYGHTMRKKGSCLEKEIMQETMPGARRRGRPHTACMEDINTWTGLPMEESVRMTEGRDKWRKYIHGVANPRTENG