| Basic Information | |
|---|---|
| Taxon OID | 3300027370 Open in IMG/M |
| Scaffold ID | Ga0209010_1000605 Open in IMG/M |
| Source Dataset Name | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 10784 |
| Total Scaffold Genes | 8 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (62.50%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Thunder Bay, Ontario, Canada | |||||||
| Coordinates | Lat. (o) | 49.08 | Long. (o) | -89.38 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F063893 | Metagenome / Metatranscriptome | 129 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209010_10006052 | F063893 | AGGAG | MSKLWEKISTLGQNASPEQTESKETVALPGDKVMHRASGTHGVVTAVETIGDVLTLTVECAHGRMLRGLDRKEFAFEGEAAYVAPPVQTVVAAPVGQAAEPMPKIEGEISSESILEKLS |
| ⦗Top⦘ |