Scaffold Ga0209589_1023296

Overview

Basic Information

• Taxon OID: 3300027357
• Scaffold ID: Ga0209589_1023296
• Source Dataset Name: Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5017
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna → Vigna unguiculata (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Root Nodules → Root Nodule Microbial Communities Of Legume Samples Collected From Usa, Mexico And Botswana

Source Dataset Sampling Location

• Location Name: California, USA
• Coordinates
  • Lat. (^o): 34.0722
  • Long. (^o): -118.4441
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F062492	Metagenome	130	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209589_10232963	F062492	GAG	LRERIIHKYFYTGSLNHKATSSLPGQPKPGFHYIQKFYKSHTKITLLNNKTHKIFYSHKNLDRNPTRITLADLKSHKANQPEAQEHPNLMVIVPSQPYMCSSSYSQAKMPPRSTKIFKTKVAAVYCRGRERELSRDE