Scaffold Ga0255124_1075283

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0255124_1075283

Scaffold Ga0255124_1075283

Overview

Basic Information
Taxon OID	3300027299 Open in IMG/M
Scaffold ID	Ga0255124_1075283 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepB_8d
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	574
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location Name	USA: New York
Coordinates	Lat. (^o)	45.0061	Long. (^o)	-74.7949	Alt. (m)		Depth (m)	5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002052	Metagenome / Metatranscriptome	599	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0255124_10752831	F002052	AGGAG	MPRIYNFKFTVECAGNGTPDMARVEEMIDLTMQDLVFDDEFIAALDEKQ

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.