Basic Information | |
---|---|
Taxon OID | 3300027296 Open in IMG/M |
Scaffold ID | Ga0209389_1073932 Open in IMG/M |
Source Dataset Name | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1796 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Root Nodules → Root Nodule Microbial Communities Of Legume Samples Collected From Usa, Mexico And Botswana |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | California, USA | |||||||
Coordinates | Lat. (o) | 34.0722 | Long. (o) | -118.4441 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F082224 | Metagenome | 113 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209389_10739322 | F082224 | GGA | MERKLIDITLPRMEDKPKSLDTQRNKGTLIKLGDSLITQELRRITLTKIDEIKLVYFLNKTQLAFIDENGSTYIGALSIRITKDT |
⦗Top⦘ |