Scaffold Ga0209215_1027768

Overview

Basic Information

• Taxon OID: 3300027266
• Scaffold ID: Ga0209215_1027768
• Source Dataset Name: Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 749
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location

• Location Name: Davy Crockett National Forest, Groveton, Texas, USA
• Coordinates
  • Lat. (^o): 31.11
  • Long. (^o): -95.15

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043511	Metagenome / Metatranscriptome	156	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209215_10277682	F043511	N/A	ALLKDMKAAGEKAANAQPVFVSQVIEGTKGTVFYVSTLRSSMGGFDNNPTMREILGEEGYKKFLQGNADTVEEADSTLFRFSPELSNPPDDVVAVAPGFWRTKAAAPAAAAKPKPKE