NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209215_1012844

Scaffold Ga0209215_1012844


Overview

Basic Information
Taxon OID3300027266 Open in IMG/M
Scaffold IDGa0209215_1012844 Open in IMG/M
Source Dataset NameForest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1039
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location
Location NameDavy Crockett National Forest, Groveton, Texas, USA
CoordinatesLat. (o)31.11Long. (o)-95.15Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005116Metagenome411Y
F010458Metagenome / Metatranscriptome303Y

Sequences

Protein IDFamilyRBSSequence
Ga0209215_10128441F010458GAGGMLMSKNNFIRPGKHGSQVTLDPGFLLTQKLYMPDGETIVKSNMTLGQAIEAIAFAHVKLQMPHLADKCNAAKIEFADGKFVVCFADSIDNLSF
Ga0209215_10128442F005116GAGGMCVYVWKFNTIPDQKVVEQFIDEQVPMFARNARHLTGGDGKPVVDLMKVEHNCGEVNLEFQLNGAEGQSGDVFCFPGYYPGDMDDDGNPLFNQCDTNGHFYCQIVETILFRAQKVFDIEVISYVNEQKQFHPAW

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.