Scaffold Ga0209215_1000075

Overview

Basic Information

• Taxon OID: 3300027266
• Scaffold ID: Ga0209215_1000075
• Source Dataset Name: Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 63419
• Total Scaffold Genes: 62
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 48 (77.42%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location

• Location Name: Davy Crockett National Forest, Groveton, Texas, USA
• Coordinates
  • Lat. (^o): 31.11
  • Long. (^o): -95.15

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036980	Metagenome	169	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209215_100007528	F036980	AGGAG	MANNDSESKDMLYLVGGVALLIAGAGLILAHPEIRRQVRAGLDRVLPGLPGNFGSGLSTVVPDFQRYMRIRAM