NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255580_1084976

Scaffold Ga0255580_1084976


Overview

Basic Information
Taxon OID3300027264 Open in IMG/M
Scaffold IDGa0255580_1084976 Open in IMG/M
Source Dataset NameAPAL treatment metatranscriptome co-assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)911
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral → Coral Microbial Communities From Various Locations To Study Host-Microbial Communication

Source Dataset Sampling Location
Location NamePanama: Bocas del Toro
CoordinatesLat. (o)9.1956Long. (o)-82.1254Alt. (m)Depth (m)15
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004690Metagenome / Metatranscriptome427Y

Sequences

Protein IDFamilyRBSSequence
Ga0255580_10849762F004690AGGLVIISSYQASPRRITVLVNFQAILLIFSGETCSNRDIFFSEDAAKKFFPTSKISAQEICHQFFLIWSNLMIMAHNMGLGNQSESWKIIMLS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.