NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208173_1029164

Scaffold Ga0208173_1029164


Overview

Basic Information
Taxon OID3300027244 Open in IMG/M
Scaffold IDGa0208173_1029164 Open in IMG/M
Source Dataset NameEstuarine microbial communities from the Columbia River estuary - metaG 1555C-02 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1054
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location
Location NameColumbia River Estuary, USA
CoordinatesLat. (o)46.2024Long. (o)-123.9409Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F060900Metagenome / Metatranscriptome132Y
F104501Metagenome / Metatranscriptome100Y

Sequences

Protein IDFamilyRBSSequence
Ga0208173_10291641F104501GGCGGMGDRANFGFKQSDGNTIFLYGHWAGHEMLANLASAVSAAEPRWQDESYATRIAISNLIGEDWKSETGWGLSVDRILDNE
Ga0208173_10291645F060900N/AEAYADSDDQDTLRAIAEALGIELVREVLFTATLEVSGTYTYNILDSDYELDLDSEVTDALYADSNNGNITIDDTEVCHVREA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.