Scaffold Ga0208678_1069392

Overview

Basic Information

• Taxon OID: 3300027233
• Scaffold ID: Ga0208678_1069392
• Source Dataset Name: Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 706
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location

• Location Name: Columbia River Estuary, USA
• Coordinates
  • Lat. (^o): 46.2328
  • Long. (^o): -123.878

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059988	Metagenome / Metatranscriptome	133	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208678_10693922	F059988	GGA	MNKFTEKRTGMPSVYKATYEEGWELKNLGNDYNENLMRNSFSNYMFRNERLSTFLDSYLKPIMTFWINKVKYLRIYYNFGVPKDYQKIN