NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208438_1028096

Scaffold Ga0208438_1028096


Overview

Basic Information
Taxon OID3300027196 Open in IMG/M
Scaffold IDGa0208438_1028096 Open in IMG/M
Source Dataset NameEstuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)954
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location
Location NameColumbia River Estuary, USA
CoordinatesLat. (o)46.2Long. (o)-123.94Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002598Metagenome / Metatranscriptome544Y
F004840Metagenome / Metatranscriptome421Y

Sequences

Protein IDFamilyRBSSequence
Ga0208438_10280962F002598AGAAGGMATKLYTIESLLVGQNYRSRNRHFEGEIINATPRPEIWYGEKTEAYLIEINTRSLRNKFATIAVKVGE
Ga0208438_10280966F004840GGAMYKITCAYDGNAPHWSADYENEFGAWENFFLFTDWGMANEYSTVNIYTPTGKCYTKVFYRSGMVAVR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.