| Basic Information | |
|---|---|
| Taxon OID | 3300027174 Open in IMG/M |
| Scaffold ID | Ga0207948_1029903 Open in IMG/M |
| Source Dataset Name | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF040 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 651 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Harvard Forest Long Term Ecological Research (Lter) Site In Petersham, Ma, For Long-Term Soil Warming Studies |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Harvard Forest LTER, Petersham, MA, USA | |||||||
| Coordinates | Lat. (o) | 42.550409 | Long. (o) | -72.180244 | Alt. (m) | Depth (m) | 0 to .1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F013129 | Metagenome / Metatranscriptome | 274 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0207948_10299032 | F013129 | N/A | RIDVIARKQLGLTEPLPEQMREYDAPSGAEVAAARYIRPNRAQ |
| ⦗Top⦘ |